SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Phvulv091005756m|PACid:23545855 from Phaseolus vulgaris v186

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Phvulv091005756m|PACid:23545855
Domain Number 1 Region: 145-244
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 5.69e-19
Family B3 DNA binding domain 0.0027
Further Details:      
 
Domain Number 2 Region: 305-388
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000000314
Family B3 DNA binding domain 0.0049
Further Details:      
 
Domain Number 3 Region: 5-51
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000844
Family B3 DNA binding domain 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Phvulv091005756m|PACid:23545855
Sequence length 389
Sequence
MDAEVWLIDEWKKFAEFFSLDQNHLLVFRYVGKSQFKVVILDHDGLEIVYPLMEGSFDDA
DNGSSFRQCKRVRFSVPSSPSTKKEKIHPRKNPNSYPTQDVETKYAESERTTVDERGRRR
NRRCSRSKVKTESGTALERAKSFISENPFFIRVMQRSHIIRKFLTMPADFITVEERKENH
RVSVWISEDKTWDMNVNVYRSKKEVSLGSGWANFVKDNNLKKGNVCVFEKIKNPGLSFRV
VIYRDAQESSPSNFSANESKETRPQKSSADRGSDGVPKNVFYDSGFRRYNNEISENHFAL
SVLKTVCIPEQFIRNHMMQNAAKVGLRVGNRTWPVKLEHYPENQCHKLCYSGWSKFMREC
KVNVGDVCNFELVDKDTFVFQVRVARCID
Download sequence
Identical sequences Phvulv091005756m|PACid:23545855

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]