SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Phvulv091005865m|PACid:23545752 from Phaseolus vulgaris v186

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Phvulv091005865m|PACid:23545752
Domain Number 1 Region: 14-106
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.73e-18
Family B3 DNA binding domain 0.0035
Further Details:      
 
Domain Number 2 Region: 199-288
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000628
Family B3 DNA binding domain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Phvulv091005865m|PACid:23545752
Sequence length 289
Sequence
MASHLGQGSATIPIHFFKIILETNVERIKLPNKFTNRYGGSLPNPVSLRASDFKEWVVYW
TEKNGEVWFEKGWKEFAENYSLSYGYFVVFKYSGTSQIDVLILDKSALELDCLSSANASV
NPVNATEKEQNARPVASSMSGNCLNLPRTLKARKISNKFKSKHPYFTLVIEPSNLEENAS
VNLNMKSLFDQFIIGIMSFFLTVVCCFTQKYVPKFLDNMNCEKNVVLQMANRSSYAWYVK
LLSGGDRYDRFSSGWSIFAKESKLEVGDICIFELVEPAGPLLRVHVFRS
Download sequence
Identical sequences V7BB85
Phvulv091005865m|PACid:23545752 XP_007142861.1.22112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]