SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Phvulv091005879m|PACid:23545702 from Phaseolus vulgaris v186

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Phvulv091005879m|PACid:23545702
Domain Number 1 Region: 15-105
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.14e-22
Family B3 DNA binding domain 0.0027
Further Details:      
 
Domain Number 2 Region: 169-261
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 8.24e-17
Family B3 DNA binding domain 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Phvulv091005879m|PACid:23545702
Sequence length 264
Sequence
MAAHPPMDHAILPIRFFKTILKSNLQRLQIPKKFTNRYGENLSNPVFLRPPDGTQWKVYW
SKQKGEIWFEKGWKQFVEHYSLDHGYFVFFTFDGTSEIDVLIVDQSSLDMQYPSSHSPEQ
SESLGHSDDESFKLLDEGPDSDHHAQGNLSLNWPREARANELARKFISCNPFFTVVIRSY
NLTSYRLNIPNLEGYIDKRKKYVTVEVGGVSWSLRLVGSDRRRLGGGWRVFAEENDLEAG
DVCIFEHIFRNDSDFRVHIFKSQR
Download sequence
Identical sequences V7BAH6
XP_007142820.1.22112 Phvulv091005879m|PACid:23545702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]