SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Phvulv091007512m|PACid:23558000 from Phaseolus vulgaris v186

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Phvulv091007512m|PACid:23558000
Domain Number 1 Region: 110-215
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.32e-30
Family B3 DNA binding domain 0.0000113
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Phvulv091007512m|PACid:23558000
Sequence length 444
Sequence
MDLIQQVKGNYSDSREEEEEEEVAEIMGITREAESSRLHHQDAASNFGKKLDLMELSLGS
TKEEERERNLQHHQHHHQHPQQQQHEHHQQHHHEGPGTCSNAKEAVEKEQMFEKVVTPSD
VGKLNRLVIPKQHAEKYFPLDSSSNEKGLLLNFEDRNGKVWRFRYSYWNSSQSYVMTKGW
SRFVKEKKLDAGDTVSFQRGLGDMYRHRLYIDWRRRTDHAHPPSDPSASPLFLPSIRWYS
LPATSPIAPPRYHHDHHFHHLNYSNLFTFQHQHQYLGHVHGAAATAASHHHNNYGEHNSG
SGPGSLYYLRSMGGGGDQNMGGRGNSIVPMIIDSVPVNVGHHNHRHGHGGMASGGGSATT
SSGKRLRLFGVNMECASSAEDSRSLSLGSGGHVTVGNSLPSSSSSLQQRLRIPHEDPLSS
SARFGDHKGGSGTSLLFDLDPSLQ
Download sequence
Identical sequences V7B3K4
XP_007139042.1.22112 Phvulv091007512m|PACid:23558000 Phvulv091007513m|PACid:23558001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]