SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Phvulv091008169m|PACid:23545123 from Phaseolus vulgaris v186

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Phvulv091008169m|PACid:23545123
Domain Number 1 Region: 28-125
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.35e-19
Family B3 DNA binding domain 0.003
Further Details:      
 
Domain Number 2 Region: 388-471
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000314
Family B3 DNA binding domain 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Phvulv091008169m|PACid:23545123
Sequence length 476
Sequence
MGGEEQGVSVCAACFHNCLLFHPTKPTSPTSFFKFITRQDYLTTLCIPPAFSSIVANMVN
KKINLNDSSGQQWKVKVSEVNGSFVFGEGWSSFSLGLGLKVGYLLVFNYIKDLHFDVKIY
DTSACEKLGFSKKRDQKKRSRGKIVSPVRDGILVRQEPNAPKMKRQCSEVDLDLPQNSKE
SGQLMHISDHCEDPCYSKRQEFDQSHGDDGTMKIENGDLNVSNVDYESNIFEKDAMTCSK
DTMFEGKFSTEVALDISELEKSGRSVSLGEAETSTYGKTSNLKFEENKAILSNMEAQECQ
FSKGLGEMKKLPEDMTPNLDSSMDELNLTGEVSKQLKKELVTLVELEATGLPTEIKGLLD
SDIFNEDNARHSKTTHLSCVVPHDNVCLKLPKCLPMIRRVKVDQLRKMVVFLRDPLRRLW
PVFYHEKPHLQLLAHGWLDFCRANNIQAKDECIFEAEVDPECKSKHILSVHIVHNK
Download sequence
Identical sequences V7AXC2
Phvulv091008169m|PACid:23545123 XP_007137956.1.22112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]