SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Phvulv091008171m|PACid:23545125 from Phaseolus vulgaris v186

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Phvulv091008171m|PACid:23545125
Domain Number 1 Region: 3-70
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000000785
Family B3 DNA binding domain 0.0033
Further Details:      
 
Domain Number 2 Region: 331-414
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000255
Family B3 DNA binding domain 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Phvulv091008171m|PACid:23545125
Sequence length 419
Sequence
MVNKKINLNDSSGQQWKVKVSEVNGSFVFGEGWSSFSLGLGLKVGYLLVFNYIKDLHFDV
KIYDTSACEKLGFSKKRDQKKRSRGKIVSPVRDGILVRQEPNAPKMKRQCSEVDLDLPQN
SKESGQLMHISDHCEDPCYSKRQEFDQSHGDDGTMKIENGDLNVSNVDYESNIFEKDAMT
CSKDTMFEGKFSTEVALDISELEKSGRSVSLGEAETSTYGKTSNLKFEENKAILSNMEAQ
ECQFSKGLGEMKKLPEDMTPNLDSSMDELNLTGEVSKQLKKELVTLVELEATGLPTEIKG
LLDSDIFNEDNARHSKTTHLSCVVPHDNVCLKLPKCLPMIRRVKVDQLRKMVVFLRDPLR
RLWPVFYHEKPHLQLLAHGWLDFCRANNIQAKDECIFEAEVDPECKSKHILSVHIVHNK
Download sequence
Identical sequences V7AWC8
XP_007137958.1.22112 Phvulv091008171m|PACid:23545125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]