SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Phvulv091008173m|PACid:23545127 from Phaseolus vulgaris v186

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Phvulv091008173m|PACid:23545127
Domain Number 1 Region: 28-125
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.63e-19
Family B3 DNA binding domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Phvulv091008173m|PACid:23545127
Sequence length 391
Sequence
MGGEEQGVSVCAACFHNCLLFHPTKPTSPTSFFKFITRQDYLTTLCIPPAFSSIVANMVN
KKINLNDSSGQQWKVKVSEVNGSFVFGEGWSSFSLGLGLKVGYLLVFNYIKDLHFDVKIY
DTSACEKLGFSKKRDQKKRSRGKIVSPVRDGILVRQEPNAPKMKRQCSEVDLDLPQNSKE
SGQLMHISDHCEDPCYSKRQEFDQSHGDDGTMKIENGDLNVSNVDYESNIFEKDAMTCSK
DTMFEGKFSTEVALDISELEKSGRSVSLGEAETSTYGKTSNLKFEENKAILSNMEAQECQ
FSKGLGEMKKLPEDMTPNLDSSMDELNLTGEVSKQLKKELVTLVELEATGLPTEIKGLLD
SDIFNEDNARHSKTTHLSCVVPHDNVCLVQY
Download sequence
Identical sequences V7AWK0
XP_007137960.1.22112 Phvulv091008173m|PACid:23545127

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]