SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Phvulv091009261m|PACid:23549200 from Phaseolus vulgaris v186

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Phvulv091009261m|PACid:23549200
Domain Number 1 Region: 112-257
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.88e-49
Family B3 DNA binding domain 0.0065
Further Details:      
 
Domain Number 2 Region: 716-792
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.000000638
Family PB1 domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Phvulv091009261m|PACid:23549200
Sequence length 844
Sequence
MKLSTSGLGQQGHEGGEKKCLNSELWHACAGPLVSLPTAGTRVVYFPQGHSEQVAATTNR
EVDGHIPNYPSLPPQLICQLHNVTMHADVETDEVYAQMTLQPLTPQEQKDTFLPMELGIP
SKQPSNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFSQQPPAQELIARDLHDVEWKF
RHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGIRRANRPQTVMPSSV
LSSDSMHIGLLAAAAHAAATNSCFTVFYNPRASPSEFVIPLSKYIKAVYHTRVSVGMRFR
MLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIEPL
TTFPMYPSLFPLRLKRPWHPGTSSFHDGRDEATNGLIWLRGGPGDQGLNSLSFQGSGLLP
WMQQRMDPTLLGNDHNQQYQAMFASGLQNLGSGDLMRQQMMNFQQPFNYLQQSGNPNPSL
QLQQPQAIQQSVSSNNILQPQAQVLADNLSQHLLQKSHNREDQTQQQHTYQDTVLLHSDQ
LHQRQLSGLPSPSYSKPDFLDSSMKFPATVSPGQNMMSSLCPEGSGNLLNLSRSGQSMLT
EQLPQQSWAPKFTPLQVNNTFGNSMPHVQQYSGKDTAMVSPHCNSDTQNPILFGVNIDSS
GLLLPTTVPRYTTASADTDASAMPLGESGFQASLYPCVQDSSELLRSAGQVDPQNQTRTF
VKVYKSGSVGRSLDISRFSSYHELREELAQMFGIEGKLEDPLRSGWQLVFVDRENDVLLL
GDDPWESFVNNVWYIKILSPEDIQKMGEQAVESLGPSSGQRLNSTGADSHEIVSGLPSIG
SLEY
Download sequence
Identical sequences V7BBY2
XP_007141982.1.22112 Phvulv091009261m|PACid:23549200

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]