SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Phvulv091009956m|PACid:23544340 from Phaseolus vulgaris v186

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Phvulv091009956m|PACid:23544340
Domain Number 1 Region: 86-126
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000049
Family B3 DNA binding domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Phvulv091009956m|PACid:23544340
Sequence length 132
Sequence
MAGGSTDESSSSTLLSSNSLHTDRSEAWDPIDSASHIPGIAIQDFSLSFPEKITLKCCQH
CQRTDIQRNQLQDYHLNLAQLVPIRKKIFRRGWANFSRRNKIKNNDVCICEVILGEDQVV
RTFLVHVGTRRE
Download sequence
Identical sequences Phvulv091009956m|PACid:23544340

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]