SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Phvulv091010887m|PACid:23549043 from Phaseolus vulgaris v186

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Phvulv091010887m|PACid:23549043
Domain Number 1 Region: 147-288
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 8.37e-47
Family B3 DNA binding domain 0.0039
Further Details:      
 
Domain Number 2 Region: 833-910
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0000000461
Family PB1 domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Phvulv091010887m|PACid:23549043
Sequence length 937
Sequence
MMASVEEKVKTGGVGVGAGAGAGGGMVVGGQTLVAEMKLLKEMQEHSGVRKNLNSELWHA
CAGPLVSLPQVGSLVFYFPQGHSEQVAASTRRTATSQIPNYPNLPSQLLCQVQNVTLHAD
KETDEIYAQMSLQPLNSEREAFPISDFGLKHSKHPTEFFCKTLTASDTSTHGGFSVPRRA
AEKLFPPLDYTIQPPTQELVVRDLHDNTWTFRHIYRGQPKRHLLTTGWSLFVGSKRLRAG
DSVLFIRDEKSQLRVGVRRVNRQQTTLPSSVLSADSMHIGVLAAAAHAAANRSPFTIFYN
PRACPSEFVIPLAKYRKAVLGTQVSVGMRFGMMFETEESGKRRYMGTIVGISDVDPLRWP
GSKWRNIQVEWDEPGCVDKQNRVSVWEIETPESLFIFPSLTSSLKRPLQSGFYENEWGTL
LRRPFMRAPDNGTMELSNSMPNLYSDHLMKMLFKPQVINNNGALLSAMQQESAATRSPFQ
EMKTALAVENMPLRNLHTQSIPDQHNPLNMQSLLRNDQPEKLHTLAKIELPSGMVTDKPK
LEPEVLPDHMLDYPSMEGSNIEKMATNPVNQQGLANQLTFHNQNQTPLTQSSPWPMQPQL
ESSMPHPQMIDMTQAETAMVNGLLPQLDIDEWMAYASSQPIAMPNRPTGPLSELQEHTSL
QPQVVNHNHPLPNHEVWDHYVKSLKFLSQTDQLTSICQPGTYGLNGMPSPNSLRDLSAES
NNQSEICVNVDVSNSVGTTVVDPSTSSTILDEFCAMKEREFQNPNDCMVGNLSSSQDVQS
QITSASLAESHAFSLRDIPDNSGGTSSSHVDFDESSFLQNNSWQQVPAPIRTYTKVQKAG
SVGRSIDVTTFKNYEELIRAIECMFGLDGLLNDTKGSGWKLVYVDYESDVLLVGDDPWEE
FVGCVRCIRILSPSEVQQMSEEGMKLLNSGALQGMNV
Download sequence
Identical sequences V7CR69
Phvulv091010887m|PACid:23549043 Phvulv091010888m|PACid:23549044 XP_007160683.1.22112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]