SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Phvulv091011071m|PACid:23549062 from Phaseolus vulgaris v186

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Phvulv091011071m|PACid:23549062
Domain Number 1 Region: 21-114
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.24e-22
Family B3 DNA binding domain 0.00098
Further Details:      
 
Domain Number 2 Region: 315-402
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 8.63e-16
Family B3 DNA binding domain 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Phvulv091011071m|PACid:23549062
Sequence length 440
Sequence
MGVQNCNGCRSWEDDIYWSHFQFLHFMQFLRAEYDQHLALPKTFSDNLRKKLPENVTLKG
PSGVAWKVAMIARGDTLYLAHGWGQFVKDHCLKENDFLVFKYNGESQFDVLVFDGGNLCE
KACSYFVRKCGHTEGEHVGGSLNRRRDTTEGCVEEGHTPSNAGVKCASPERSVHANGSKE
PINVPFETPTRSEEALNADVESGGAEQVRSVGIPLSAVPTETANGKRIRKLVSAVKHVQT
KRRGRPAKVSHVMERAKVIDRAIDWVSGVESGEPVSAVKSGSYELFISNRRPVTEDEIKN
AFALAQAERTEDGLVIVMRPSHVYKRFFVSMPNKWIGEHISPMSQDVILRMGKGEWIARY
SYHNIRHTGGFTGGWKHFVLDNNLEEYDVCVFKPAGQMNETMVIDMAIFRVVQETVPLSV
MSPSGKRARKSAQNANLTET
Download sequence
Identical sequences Phvulv091011071m|PACid:23549062

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]