SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Phvulv091012738m|PACid:23539779 from Phaseolus vulgaris v186

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Phvulv091012738m|PACid:23539779
Domain Number 1 Region: 138-271
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 9.16e-40
Family B3 DNA binding domain 0.0037
Further Details:      
 
Domain Number 2 Region: 715-792
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0000000000186
Family PB1 domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Phvulv091012738m|PACid:23539779
Sequence length 843
Sequence
MASSEVTMKGNCLNHIDGGASEAQSPATAKDAEAALFRELWHACAGPLVTVPREGERVFY
FPQGHIEQVEASTNQVADQHMPVYDLPPKILCRVINVQLKAEPDTDEVFAQVTLLPEPNQ
NENDVEKEPPPPPPPRFHVHSFCKTLTASDTSTHGGFSVLRRHADECLPPLDMSKQPPTQ
ELAAKDLHGNEWRFKHIFRGQPRRHLLQSGWSVFVSSKRLVAGDAFIFLRGENGELRVGV
RRAMRQQGNVPSSVISSHSMHLGVLATAWHAILTGTIFTVYYKPRTSPAEFIVPYDQYME
SLKNSYSIGMRFKMRFEGEEAPEQRFTGTIVGIEDSDPNRWRESKWRCLKVRWDETSNTP
RPERVSPWKIEPALAPPALNPLSMPRPKRPRSNAIPPSPDSSVLTREASSKVSIDPSPAN
GFPRVLQGQEFSTLRGNYTESIDSDAAEKSVVWPPAAVDDEKIDVSTSRRYGSESWMSMG
RNEPTYSDLLSGFGAGGDSSHSSFMDQMSPVAYPTRKQSSDHEGKLHMPQPWPVMPSSLS
LNILDSNTKGPAHGGDPTYQARGNLRYSAFGEYPALHGHKVEHSHGNLMPPPPPAPVNQY
QIPCSRELMLKPVPAKTFEAVKLKDGDCKLFGFSLISGPIVPEPPVSQRNMNEPTGQMHL
TPHQQRTSENDEKSDHSKGSKTADDLIVDDHDRPLQASQLHAKDGQAKPLSSSARSCTKV
HKKGIALGRSVDLTKYTGYDELVAELDQLFEFEGELLSTKKDWLIVYTDNEGDMMLVGDD
PWQEFCAMVRKIYIYPKEEIQKMSPGTLSSKNEENQSGSEGADAKDVKCLPPQKFNYENG
LDA
Download sequence
Identical sequences V7B042
XP_007137862.1.22112 Phvulv091012738m|PACid:23539779

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]