SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Phvulv091013729m|PACid:23553440 from Phaseolus vulgaris v186

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Phvulv091013729m|PACid:23553440
Domain Number 1 Region: 29-125
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.92e-24
Family B3 DNA binding domain 0.00029
Further Details:      
 
Domain Number 2 Region: 211-296
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000549
Family B3 DNA binding domain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Phvulv091013729m|PACid:23553440
Sequence length 319
Sequence
IYPRQSQNLSSEVINLSENIRRMESARQALEFFKVFLLNKASTQLQIPTSFTKFFNGIAP
CKIILIDHDGKCWDVKLEKIEGRLVFKNGWQQFAKEKNLEEGDFLVFQYDGMSTFNVKIF
SKTGCRKGATPPSREKVVPIVNLEKDSDEFGNKIQSNGIGKRSLPNTKLKLESVLEGACP
SEGARRRSKRLKEEKDKKNDKKLALTKHVPLQNPHFQIYFDTPWRLKRVEIPKKPIKDME
IKLIGNIILRDENDRSWPVSIISTANQDRRYLGSGWLDFRQCNNIEEGCQCDFQFVVDKA
NVAKELLVRVRSKGGLQIV
Download sequence
Identical sequences Phvulv091013729m|PACid:23553440

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]