SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Phvulv091013862m|PACid:23538279 from Phaseolus vulgaris v186

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Phvulv091013862m|PACid:23538279
Domain Number 1 Region: 98-198
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000000118
Family B3 DNA binding domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Phvulv091013862m|PACid:23538279
Sequence length 214
Sequence
MQGEKDPQKWHENIFGNKRCKHSQNIAEELGEASRFKDGGDVSLENLDQEAEFLSESSSP
EVCFSSQEHLIRDSYSPSSLPAMENFREYILEHGEPLHKKLTTSDVNVNQNRLLLNKNHV
EKSFLPLLKNDENIERGIQVPVYDAHQNTFSLTFKKWTNKYYVLNGGWKDFFQVHKLQKD
DSITVCIFRHSSHNKLCFALDYKKIGGDKIQNLS
Download sequence
Identical sequences V7BSP3
XP_007148990.1.22112 Phvulv091013862m|PACid:23538279

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]