SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Phvulv091013908m|PACid:23531455 from Phaseolus vulgaris v186

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Phvulv091013908m|PACid:23531455
Domain Number 1 Region: 28-127
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.77e-22
Family B3 DNA binding domain 0.0059
Further Details:      
 
Domain Number 2 Region: 249-344
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.94e-22
Family B3 DNA binding domain 0.0024
Further Details:      
 
Domain Number 3 Region: 380-482
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.92e-21
Family B3 DNA binding domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Phvulv091013908m|PACid:23531455
Sequence length 484
Sequence
MLVNFKALKIPSSLCDDISTSMTSPTNLSSTVVHFCKIILRPNLAHGILNLPKMFTRKHG
DGMSNPVFLRSPDGTEWKIYWVRSDGEIWFQNGWKEFATYYSLDHGHLLFFEYQGTTHFQ
VHIFDNSALEIDYPSHTTHCRKENLVHISDDSNELLLEQLSCQNTRVKPTLSSPQPCKKM
KNSITTNVVRSPNLVHLHQHVQTKSPSIQEEKSIKQKLHEVEGKHAFNSECSKVEQLTST
ALKKAITFRPEHPFFLLVMKESLIKRYYLKIPPHFVEKYLKNTREVVNLEVLDGRTWPVI
YSAPRISGGWKKFASENNLNVGDVCVFEMIKRIQGLAFIVSIFRGAEEPSFPISQVKDFQ
LESDFKSKILTRAHKEASKFKSENPFFMVTLPSKENTTRYLCVPIYFARKYLIKFNQNVM
MIQFRNKLWPVKFVCNSSSSAKFSAGWALFARENNLKPGDICVFELVNRKDATLVVHVFR
SHGN
Download sequence
Identical sequences Phvulv091013908m|PACid:23531455

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]