SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Phvulv091014815m|PACid:23532628 from Phaseolus vulgaris v186

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Phvulv091014815m|PACid:23532628
Domain Number 1 Region: 155-269
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 9.94e-43
Family B3 DNA binding domain 0.0036
Further Details:      
 
Weak hits

Sequence:  Phvulv091014815m|PACid:23532628
Domain Number - Region: 43-52
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00034
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Phvulv091014815m|PACid:23532628
Sequence length 734
Sequence
MGLIDLNTTEDDEAPLSASSSSAASSSSSHSGISTSASTLVVPPPPPPPPPPSVCLELWH
ACAGPLISLPKKGSVVVYLPQGHFEHVQDFPVTAYDIPPHVFCRVLDVKLHAEEGSDEVY
CQVLLVPESEQLEQSLREGEIEADGEEGDTEAMVKSTTPHMFCKTLTASDTSTHGGFSVP
RRAAEDCFPPLDYSQQRPSQELVAKDLHGLEWRFRHIYRGQPRRHLLTTGWSAFVNKKKL
VSGDAVLFLRGDDGELRLGIRRAAQLKGSGSFAVPSGQQLNPGTFMDVVNALSTRCAFSV
CYNPRFSSSEFIIPSHKFLKSLDSSYLVGMRFRMRFETEDAAERRFTGLIAGISDVDPVR
WSGSKWRCLLVRWDDMEAARHNRVSPWEIEPSGSASSSSNMMAAGLKRTRIGMNSTKMEF
PSPNGIGTSDFGESLRFRKVLQGQEILGVNPPFDGINAPSPRLYDLGRYYLGPNCSGIPP
TGNNIRMPHAASDFSCNGTGFSESFGFQKVLQGQEILPSQPYGRSLSFEEARANGRFGHF
DGYQLLNSRNGWSVQMHDNAPHLHASVTPSQVSSPSSVLMFQQAVSPVSNCDYNNKKHSK
MYQGLCASEVKARTFASSQSDDHTFSRRAPERASSLGMFDVHNQLGSSQSHNSVSALRNN
QELVSSCKSSCRLFGFSLTEDAHVANKEVDASTITLPLNAGPSFTRLVEDEFHPSRALQS
KAVGSNCIKGVLQY
Download sequence
Identical sequences V7BSU4
Phvulv091014815m|PACid:23532628 XP_007148104.1.22112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]