SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Phvulv091015033m|PACid:23532646 from Phaseolus vulgaris v186

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Phvulv091015033m|PACid:23532646
Domain Number 1 Region: 333-435
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 8.24e-20
Family B3 DNA binding domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Phvulv091015033m|PACid:23532646
Sequence length 878
Sequence
MASASSSSSKLCFNSDCKELRPERPKKGWRLRSGELAELCDRCGSAFEDGKFCEIFHSNA
SGWRSCETCRKRIHCGCIVSSHSFMLLDPGGIECYTCARKNIIMPSNLPWPQSFSLQNRL
SDRLRDLSAKGWNQLAGSGPVPWKQAPSLFNSASSSDLISDVPSLAELSSSFDKMYCNER
LPASALEKKSEDFPGLPVHWNVTICPREMKHMNGMRNEDKASSCLNMCQQPSSMKEESSP
QPFGLPVPNSCQNERNGQLGVTGSHPQQTPPPPGKQFNGTMHLAPDSSGEAQVRNGRPRA
DARGRNQLLPRYWPRCTDLELQQISIDSNSVITPLFQKTLSASDAGRIGRLVLPKKCAET
YFPPISQPEGLPLKILDAKGKEWIFQFRFWPNNNSRMYVLEGVTPCIQSMQLQAGDTVTF
SRLEPEGRLVMGFRKASSAAPSDQDNETNKSGNGFSAHGEVELADPNSWSKVDKSGYIAK
EALGSKSLISRKRKSGLLGSKSKRLRIENEDLIELKITWQEAQGLLRPPPSHIPSIVVIE
GFEFEEYEEAPVLGKPTIFTSDNVGEKIQWAQCEDCLKWRKLPASALLPSKWTCSDNSWD
PERSSCSAAQELTAEQLENLLPPCNSAVPKRMKATKQDPDNAEALEGLDTLANLAILGEG
EALPASAQATTKHPRHRPGCSCIVCIQPPSGKGPKHKQTCTCNVCLTVKRRFHTLMLRRE
KKQSEKEAETTRKKQQQQHPQPLPSSEILLDEDSLPCSNTGDSSPNQNREGNDGSDDDPN
RIKSSASPFKGQIDLNIQPEREEELSPGSDSGGMMKLLHDAATERYLKQQTVNSGTGDSA
GSQSQLVGDAMREDKLSNGVTHGSSSHSTDRNMANLCP
Download sequence
Identical sequences V7BQJ4
Phvulv091015033m|PACid:23532646 XP_007148240.1.22112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]