SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Phvulv091015255m|PACid:23555609 from Phaseolus vulgaris v186

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Phvulv091015255m|PACid:23555609
Domain Number 1 Region: 203-307
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.7e-24
Family B3 DNA binding domain 0.0073
Further Details:      
 
Domain Number 2 Region: 30-122
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 5.69e-16
Family B3 DNA binding domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Phvulv091015255m|PACid:23555609
Sequence length 312
Sequence
MTMRDFSFYQKALIIQGNGRETWQMDYYQGNPVFFIIVNNTKLQKVPEGFLKHLNEDLPN
AVLVSPTGDNWQITILKKGNNMYMQSGWPQFLTDNSVMLDDFLLFTYHGGNCFHVQIFGK
NGLERLCFKQTRQDQVLIPSLVRTKKSTQRRTFSSSFLHQAKSCKKGLSFSNKISFSKDF
QKLKSSIKIESTEACNLADSFTSRNPHWKHLMTKCNVEDHCTLPIATEFARKHIPEAVKQ
IILWNTEGKFWEVVVTWFGCQNKRYTRFTTGWGRFVRDNRLMRGDTCIFELEDENHLSVH
IFRTGLCAPRLF
Download sequence
Identical sequences V7AGC6
XP_007131909.1.22112 Phvulv091015255m|PACid:23555609

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]