SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Phvulv091015287m|PACid:23555443 from Phaseolus vulgaris v186

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Phvulv091015287m|PACid:23555443
Domain Number 1 Region: 232-337
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.35e-21
Family B3 DNA binding domain 0.0066
Further Details:      
 
Domain Number 2 Region: 7-104
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 7.26e-21
Family B3 DNA binding domain 0.00081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Phvulv091015287m|PACid:23555443
Sequence length 340
Sequence
MTSGAKKYPHFFKIFLPEQDSHIMKVPKEFLKHLDEDLSSNAVLSGPSSGEQWQVSVLKK
GNDVYMQNGWPEFVTDNLVVLNEFLLFTYHGDNCFHVQIFGKNGLERLCLRETRQEQAAA
IPKNSTQTFAGLSPHKSKSCKRDTPFSNKDFIFTGCETMETRQKQTATPSLATTKKNKER
KFSPGASHLQESKSYQQDLSFSNKASLPKDFPTPQHSIEIESSKAWKLAESFTSCNPHWK
HLMTKSNVEDCCILPIATEFARKYIPEAVKQIHIGNCKGTSWKVQVNCFKNQDRRYAQLT
TGWVNFVRENKLMRGDTCIFELEEDFHFRVHIFRTSCAPR
Download sequence
Identical sequences V7AIH4
XP_007131907.1.22112 XP_007131908.1.22112 Phvulv091015287m|PACid:23555443

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]