SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Phvulv091015374m|PACid:23555547 from Phaseolus vulgaris v186

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Phvulv091015374m|PACid:23555547
Domain Number 1 Region: 6-102
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 5.89e-17
Family B3 DNA binding domain 0.002
Further Details:      
 
Domain Number 2 Region: 309-360
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000179
Family B3 DNA binding domain 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Phvulv091015374m|PACid:23555547
Sequence length 364
Sequence
MSGAEKYPDFFKVFLQEQHYERMLIPNAFVKLQGLQGRIPEDVLLRNRSERVWHVKTRFF
GDKLYFDDGWKIFHEENCLGNADFLVFRYDGVNEFRVTILEISTQCEKTLVKIEEEEEGN
EEERAAAQVEETVITQEEQAEDCDIEDEEDSQDQDYDDDNDDSDFDDHDHDDDDDENTEM
EEESEEENSVGPVGYASQHYRKPYRRDTASSSYPQTEEDTFKDDEFDPEMCIQPENNFFE
AKLYRSRPNELHIPGIAIQDFSLSFPEKITLKCCQHCQRKDIQRNQLQDYHLNLAQQAPI
RKRYLEVTGKVCRWQDDRICIKGWANFSRRNKIKNNDVCICEVISGEDQVVRTFLVHVIG
TRRE
Download sequence
Identical sequences V7AGC2
XP_007131904.1.22112 Phvulv091015374m|PACid:23555547

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]