SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Phvulv091015387m|PACid:23555421 from Phaseolus vulgaris v186

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Phvulv091015387m|PACid:23555421
Domain Number 1 Region: 289-390
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1e-24
Family B3 DNA binding domain 0.0037
Further Details:      
 
Domain Number 2 Region: 2-96
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 8.04e-24
Family B3 DNA binding domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Phvulv091015387m|PACid:23555421
Sequence length 430
Sequence
MTHPSFHKLLLPSTLQPNQLRLPDDFMRKYGRELSPIVTLSVPDGSVWRVGLKKADNKYW
FLDGWQEFIQHYSIGVGYLLVFRYEGKSSFNVHVFNLATSEINYQSAMRCSNEGPHFANL
LKFFEEMDDEDSIEILDSSPSHLAPSSLQNKVLAGSVDKMSPAKCYTPPALQNLFNGSKL
NSINWGEGGDAHCSKSVNSLDNLLTRDIGVQFNAVEFKKSTEELKLRASMEERMKKTARK
KRKSEGQEASAEQEEEVEMRFRFYESASARKRTVTAEERERAINAAKAFEPPNPFCRVVL
RPSYLYRGCIMYLPSCFAEKHLNGVSGFIKLQISNGRQWPVRCLYRGGRAKLSQGWFEFS
LENNLGEGDVCVFELLRMKEVVLQVSIFRITEDVGLLSPPPLQQNQKMSSAKLLNTPLQQ
HLTSTKIIRN
Download sequence
Identical sequences V7AEE9
XP_007131905.1.22112 Phvulv091015387m|PACid:23555421

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]