SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Phvulv091015950m|PACid:23547248 from Phaseolus vulgaris v186

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Phvulv091015950m|PACid:23547248
Domain Number 1 Region: 133-243
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000122
Family B3 DNA binding domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Phvulv091015950m|PACid:23547248
Sequence length 249
Sequence
MRDLKTLKELVASITDAESLEKLSSKSFKPSLLDYAISQHAPHFYSEQELIQLHVFFKQL
SSSFHQRENTDNTPTIIRKRKTQDMPKEETVVPKIKKLRVIVRCTTPPPPKELPIEFKNR
IKELSGCDLQFLMHKRLFHSDVKTNNNRLSMPIKEIRADFLTKEEITKLNERENGSNDGR
LIGLEVIVLDPCLREYTLPIKMWSMNTNTYNLVKEWNKIVSANKFKEDQELQIWSFRVNN
KLHLLLNKL
Download sequence
Identical sequences V7BKI7
XP_007146483.1.22112 Phvulv091015950m|PACid:23547248

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]