SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Phvulv091015963m|PACid:23547100 from Phaseolus vulgaris v186

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Phvulv091015963m|PACid:23547100
Domain Number - Region: 112-139
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00259
Family B3 DNA binding domain 0.012
Further Details:      
 
Domain Number - Region: 57-139
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00302
Family B3 DNA binding domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Phvulv091015963m|PACid:23547100
Sequence length 139
Sequence
MELRNFYGLLGDHDILIGYVGASAFQLTVFRSDAGQLAVNNYFSQLSTTEAAFEGQFVHY
RLTLNAYIYSDEYLVLFGEGFESYVWDSNLRIFMLCGPLVHQIFEAETSPISSNTFYLRP
RWNNICMLNEFQEGDTITF
Download sequence
Identical sequences V7BPE0
Phvulv091015963m|PACid:23547100 XP_007146452.1.22112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]