SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Phvulv091016457m|PACid:23539094 from Phaseolus vulgaris v186

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Phvulv091016457m|PACid:23539094
Domain Number 1 Region: 117-213
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.92e-23
Family B3 DNA binding domain 0.0048
Further Details:      
 
Weak hits

Sequence:  Phvulv091016457m|PACid:23539094
Domain Number - Region: 402-450
Classification Level Classification E-value
Superfamily GreA transcript cleavage protein, N-terminal domain 0.0102
Family GreA transcript cleavage protein, N-terminal domain 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Phvulv091016457m|PACid:23539094
Sequence length 483
Sequence
MVVIDERNRDRANRRDVVEFPQYDQAVTVAYYGEELHGGVPLPHSSRMSPLNMDKQNKVV
ENKYKRLNNNQTKQATPAEAQKFSSSMKAAVEGTSSRGEVMSSAVLQAEEVQSNLRPEFP
SFVKSLIRSHVASCFGMGLPVSFCKRHLPDKDTTIILEDEYGKEYNTKFIACKMVLSAGW
RQFSAEHKLQEGDAVVFQLVEPTKFKIYIIRANNTRELDGAFLNLDSCTKQKMGGKDSTD
TDVVTCNSSKRKHGKSVPLDIQKKKKANLSRLRPKAGPSVEQSENDSEEALSEVVEEFKM
LEFEDMRGFENFSIIVEGVSIDVEFPTEVRNKYYRLCCSQHAFLHENLIKGMNYKLIAGI
ISETVNIADAIRVSVICTPRFEFANWDKTLLAFEHLGMNVEFLRIRLRRLVSIAYEKNDV
SEAKKYLAYRNEPSRADDEIRIMEVKLEELKGACNGFGAYLGSLKGKAENYQMKFRREVD
APW
Download sequence
Identical sequences V7CF75
Phvulv091016457m|PACid:23539094 XP_007155931.1.22112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]