SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Phvulv091017603m|PACid:23547298 from Phaseolus vulgaris v186

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Phvulv091017603m|PACid:23547298
Domain Number 1 Region: 121-260
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.32e-42
Family B3 DNA binding domain 0.004
Further Details:      
 
Domain Number 2 Region: 1007-1072
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.00000353
Family PB1 domain 0.029
Further Details:      
 
Weak hits

Sequence:  Phvulv091017603m|PACid:23547298
Domain Number - Region: 976-987
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0497
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Phvulv091017603m|PACid:23547298
Sequence length 1106
Sequence
MKTHPPQPEGGSAAPNPTQEKRSINPELWQACAGPLVNLPPSATHVIYFPQGHSEQVAAS
LKKDVDSQIPNYPNLPSKLLCLLHNLTLHADPETDEVYAQMTLQPVPSFDKDALLRSDLA
LKSTKPQPDFFCKQLTASDTSTHGGFSVPRRAAEKIFPHLDYSMQPPAQELVARDLHDNV
WTFRHIYRGQPKRHLLTTGWSLFVSGKRLFAGDSVLFIRDEKQQLLLGIRRANRQPTNIS
SSVLSSDSMHIGILAAAAHAAANNSPFTVFYNPRASPSEFVIPLAKYYKSVYSHQPSLGM
RFRMMFETEDSGTRRYMGTITGISDLDPVRWKNSQWRNLQVGWDESTAGEKRSRVSIWEI
EPVTAPFFLCPPPFFRSKRPRQPGMPDDELSDFDNIFKRTMPWLGDDMCMKDPQGLPGLS
LAQWMNMQQNPALASSLQPNFAPSLSGSILQNIPGADISRQLGFSAPQISPSNNVAFNTQ
RLLQTAQQLDHLQKLPSTSSTLGTVLPPQQQLGDITQQSRQNLANQTMPQGQVQAQLLHP
QNIVQTNNIQQQQPSIQNHQMHRSLSQNPSQQQTIIGQSPIPDHLQQLQMSDNQIQLHLL
QKFQQQQQKQTHLAQQTVLQQPTQLTQIQDQQRQILDKTHNLSRAVTPGQVLEIPPLLKN
SLPEANSISNQITKANFQNNIQFPQQPKLQQQQPGLLSEMSGHMALLPTHTTNQLSAAGS
SILNGAAGAGQSVITDDIPSCSTSPSTNNCASALAPLINSRLQRNTIVGDDMAQSASTIL
SSSALETMSSNANLLKDLQPKCDVKPSLNISKNQNQGHFGLQSYLNGSAAHTDCLDTSSS
TTSVCLSQSDAHMHQNNNPLAYNPHSMLFRDNSQDGEVQADARGNIPYANNMDSQMGMQL
NPDSLLTKGTLGLGKDLSNNFSSEGLLGNYENNRDAQQELSSSMVSQTFGVPDMAFNSID
STIDDSSFLNRGTWAPPPAPPPPPLPPTQFQRMRTYTKVYKRGAVGRSIDITRYSGYEEL
KQDLARRFGIEGQLEDRQRIGWKLVYVDHESDVLLVGDDPWEEFVNCVRCIKILSPQEVQ
QMSLDGDFGNGGLPNQACSSSDGGNT
Download sequence
Identical sequences V7C4C0
XP_007152995.1.22112 Phvulv091017603m|PACid:23547298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]