SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Phvulv091017815m|PACid:23538003 from Phaseolus vulgaris v186

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Phvulv091017815m|PACid:23538003
Domain Number 1 Region: 117-255
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.57e-43
Family B3 DNA binding domain 0.0046
Further Details:      
 
Domain Number 2 Region: 1049-1114
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.000000011
Family PB1 domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Phvulv091017815m|PACid:23538003
Sequence length 1163
Sequence
MKAPSNGFLPNSGEGERKTINPELWHACAGPLVSLPPVGSLVVYFPQGHSEQVAASMQKE
TDFIPSYPNLPSKLICMLHNVALHADPETDEVYAQMTLQPVNKYEKEAILASDMGLKQCR
QPTEFFCKTLTASDTSTHGGFSVPRRAAEKIFPTLDYSMQPPAQELVAKDLHDNTWPFRH
IYRGQPKRHLLTTGWSVFVSTKRLFAGDSVLFIRDEMKHLLLGIRRANRQQSALSSSVIS
SDSMHIGILAAAAHAAANNSPFTIFYNPRASPSEFVVPLAKYNKAMYTQVSLGMRFRMMF
ETEESGVRRYMGTITGISDLDPARWKNSQWRNIQVGWDESTAGERPSRVSIWEVQPVVTP
FYICPPPFFRPKFPRQPGMPDDESDMENTLKRGMPWLGDDFGMKDASSSIFPGFSLVQWM
NMQPNNHLSAAQSGCFPSMLPSNTLHGNLATEDPSKLLSFQAPVLSSPSLQLNKPNLPNQ
INQLQQSPVSWPQQQQQQQQLQQQQQQQLQQQQLQQQQQQLQQQQQQQQLQQQQQLQQQQ
QLQQQQQQQLQSLLQIPMNHLQQQRQQQLPEPQNLSLLQQLPQQLGQQPQKQQQPSQHAT
LMHNGVVASNQITSQFVQPPMAYGQLQQQQLLSGGIQPQQGIQSASKNTFPLTSLSHDSQ
FQQQIDQQANLLLRQQQQQQTQLQQSPLQLLQHNLPQIPSQQQLPASQMLQPNSSEQQLH
LQLLQKLQHQQQQQHLSTSTPLLQSQLLPQQNTHQQNQQLPQTQPPVSHHQPHQVANNAL
STEKLLNSNNFSSSSLMQSQQIPMNQSQNTQKSLTITRAPSTLTDGDAPSCSTSPSTNNC
QVSPPNLLKRNQQLPATLGGSLIVEPTSNLIQELHSKPDMQNKHDLLNLKGPDQLKYKGI
ITDQLEASSSGTSYCLDPGNVQQNLPLSNFCMEGDAQSHPRNSLPFDTNLDDLTPDTMLL
RGYDSSKDLQNLLSNYGGAPRDIETELSTADISSQSFGVPNMPFKPGCSSDVVINEAGVL
NNNGLRANQPPPPRMRTYTKVQKRGSVGRCIDVTRYRGYDELRHDLAKMFGIEGQLDPQR
TDWKLVYVDHENDILLVGDDPWDEFVSCVQSIKILSHSEVQQMSLDGDLGGTVPIPNQAC
SGTDSGNAWRGQYEDNSAASFNR
Download sequence
Identical sequences V7C8N6
XP_007154558.1.22112 Phvulv091017815m|PACid:23538003

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]