SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Phvulv091018208m|PACid:23551182 from Phaseolus vulgaris v186

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Phvulv091018208m|PACid:23551182
Domain Number 1 Region: 122-263
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.32e-40
Family B3 DNA binding domain 0.0029
Further Details:      
 
Domain Number 2 Region: 591-671
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.00000000000445
Family PB1 domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Phvulv091018208m|PACid:23551182
Sequence length 717
Sequence
MAHLEAAVRSVPSSQPETGVEDGDLYTQLWKLCAGPLVDVPCEGERVFYFPQGHMEQLQA
STNQGLNQELNQQIPHFNLPSKILCRVVHIQLLAEQETDEVYARITLLPESNQEEPTTPD
PSVPETQKQSFHSFSKILTASDTSTHGGFSVLRRHATECLPQLDMTQTIPTQELAAKDLH
GFEWKFKHIFRGQPRRHLLTTGWSTFVTSKRLVAGDAFVFLRGENGELRVGVRRVARQQS
PMPSSVISSQSMHLGVLATASHAFLTSTMFVVYYKPRTSQFIIGLNKYLESVNKFSVGMR
FKMRFEVEDSPERRFSGTIVGVGDVSPGWRNSQWRSLKAQWDEPAIIPRPERVSSWEIEP
FVASTALNVTQQVVKSKRSRPPEVSSSEIGPNSPATALWYHGPSLSHDPTALGGTSEVQS
NESPVIWSTRMKEINVNPMNGNKSSSSRVRVEGMWPSSPHLSVSSNLFPDPKNSKAVTAQ
SNVSGYAPVSCRPNDDLAHDPVECGKRSENPMDCWVFGVNLTNNFTNVALPDKELGCPAI
IIPSGPKDSIPVAACETQAGQNHNYSLSNKVQKQIISDGSPSERHAKQATVPSTRTRTKV
QMQGVAVGRAVDLTVIKDYEALIDELEKIFDIKGELRMQTKWAITFTDDENDMMLAGDDP
WPEFCCMAKRIFICSREDVNKLKNKHSACSSEAEETLLSQDSQNREETQQVSCDLTA
Download sequence
Identical sequences V7BMV7
XP_007147325.1.22112 Phvulv091018208m|PACid:23551182

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]