SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Phvulv091019329m|PACid:23536897 from Phaseolus vulgaris v186

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Phvulv091019329m|PACid:23536897
Domain Number 1 Region: 127-263
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.53e-34
Family B3 DNA binding domain 0.0021
Further Details:      
 
Domain Number 2 Region: 572-643
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.00000912
Family PB1 domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Phvulv091019329m|PACid:23536897
Sequence length 667
Sequence
MRRRREMEPEPRDGLPRNRGPGDDLYTELWRACAGYSVHVPRVGELVFYFPQGHLEQVAA
FTQHQQDGHMEIPASGLPSKILCRVVYVQLQAEIYTDEVFAQVTLVPEAKQNDFDLENED
NHVPLRTATYSFSKVLTPSDTSTHGGFSIPKRHADECFRPLDMTHQTPAQEILAKDLRGF
EWHFRHIYRGQPKRHLLTSGWSTFVNAKKLVAGDSCIFVSGESGEVRVGIRRANRHPSNA
SLSSSLISGHSMQLGILASASHAVSTGSLFTVYYHPWTNPFEFIIPLEKYLKSTVPDYSI
GARVQMQCDVEESLRRYAGTIIGTEVIDSIRWPGSEWRCLKVQWDAAVDAFMHPERVCPW
WIEPLESATEKHFPVLPNPKRPHLLNQHPLPGLSVFGMNDAGQSSARAASQTQRTDRDLQ
GQDYSGLSTSWPLQRPSSSDVINPSKFSISGSQFGKENLNQLPFHMQDILHKSLGRSTSL
AHEDLSISSSNLGSICSDSLGWPPYESRNENDAPFGQLGSCSRYKLFGVSLIDRQPELPS
SQPSSLRSTPPMSVTSGKTCQKCRSVNRSCTKVIKLGTALGRAVDLSRFRGYDELIAELD
SMFDFGGGLVNGSSGWHVTCIDDDGDMMFLRDYPWQDFQCVVQKMIICQKDGINSLNPRS
SADPPSL
Download sequence
Identical sequences V7D1H2
Phvulv091019329m|PACid:23536897 XP_007163052.1.22112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]