SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Phvulv091019721m|PACid:23536044 from Phaseolus vulgaris v186

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Phvulv091019721m|PACid:23536044
Domain Number 1 Region: 122-219
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.59e-24
Family B3 DNA binding domain 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Phvulv091019721m|PACid:23536044
Sequence length 228
Sequence
MVAASAYEESRRKRLEENRKRMEALNLPLLSRALHKSHSPASSPSKSVKKRNIQEPMVVV
RRSGRLANLPSPIYKEIVIDRVSIARRNIGNRHRDFVNRVYASDESRKEALEKAENLTSG
LESDYPNFIKSMLQSHVSGGFWLGLPVHFCKSNLPKGDEVMTLIDEDGNEYPTIYLPRKS
GLSGGWKGFAVAHDLADGDALIFQLIRRTAFKVYIIRANSASEDKQLK
Download sequence
Identical sequences V7AWT6
Phvulv091019721m|PACid:23536044 XP_007136672.1.22112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]