SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Phvulv091022000m|PACid:23543554 from Phaseolus vulgaris v186

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Phvulv091022000m|PACid:23543554
Domain Number 1 Region: 112-256
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.05e-48
Family B3 DNA binding domain 0.0049
Further Details:      
 
Domain Number 2 Region: 774-850
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0000051
Family PB1 domain 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Phvulv091022000m|PACid:23543554
Sequence length 908
Sequence
MRLSSAGFSPPPQEGERRVLDSELWHACAGPLVSLPAVGSRVVYFPQGHSEQVAVSTNKE
IDAHIPNYPSLPPQLICQLHNMTMHADAETDEVYAQMTLQPLNPQEQKEAYLPAELGTPS
KQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPALDFSQQPPAQELIARDLHGNEWKFR
HIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGIRRANRPQTVMPSSVL
SSDSMHLGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPLAKYVKAVYHTRVSVGMRFRM
LFETEESGVRRYMGTITGISDLDPTRWPNSHWRSVKVGWDESTAGERQPRVSLWEIEPLT
TFPMYPSPFPLRLKRPWPPGLPSFHGMKDDDFGLNSSLLWLRDSDRGLQSPTFQGIGVNP
WMQPRFDPSMLNMQTDMYQAAAAAAAVQEMRGLDPSKQHSASILQFQQPQNFPNRTAAFV
QAQMLQQTQHQQIFGNNQENPHSPQSHLQTQAHLQQQLQHQHSFNSQNHHQHQQQQLRQT
QQQQQQQQVVDNQQISSAVSSMSQFVSAPPPQSPPMQAISSLCQQQNFSDGNSVPTIVSP
LHSILGSFPQDETSHLLNLPRTSSWIPVQNSSGWPSKRVAVDPLISSGVSQCVLPPVEQL
GQPQSTVSQNAITLPPFPGRECSIDQEGSNDPQNHLLFGVNIDPSSLLMPNGMSNLKGVS
SNNDSSTLPYQSSNYLNTTTGTDSSLNHGITPSIGGESGYLQSPENAGQGNPLNKTFVKV
YKSGSFGRSLDITKFSSYHELRSELAQMFGLEGELEDPVRSGWQLVFVDRENDVLLLGDG
PWPEFVNSVWCIKILSPQEVQQMGNPGLELLNSVPIQRLSNGICDDYVSRQDPRNISPGI
TAVGSLDY
Download sequence
Identical sequences V7CMF5
XP_007159383.1.22112 Phvulv091022000m|PACid:23543554

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]