SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Phvulv091022320m|PACid:23552548 from Phaseolus vulgaris v186

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Phvulv091022320m|PACid:23552548
Domain Number 1 Region: 108-221
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000000049
Family B3 DNA binding domain 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Phvulv091022320m|PACid:23552548
Sequence length 223
Sequence
MRERRHRRKGKERLSSTTRIGLFQHGDKEEETNKRTKIEEGSGNGKSVFEYLLEAVSLFS
EEEQNSLVNMHASVDDEEEEGDESGELLPREFQKKIQDLNGCEVKFVTKKKLFSTDLNPK
HARLSIPPTKIANRFLSQTEESSLEEGIRENGKLVGLSVTVLDPSLKEYKMSLKKWKMEK
SNVYNLTKGWNQIVRHNDLQLHQTLQLWSFRVSSQLCFALVKI
Download sequence
Identical sequences Phvulv091022320m|PACid:23552548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]