SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Phvulv091022740m|PACid:23558532 from Phaseolus vulgaris v186

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Phvulv091022740m|PACid:23558532
Domain Number 1 Region: 291-392
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.63e-24
Family B3 DNA binding domain 0.0032
Further Details:      
 
Domain Number 2 Region: 3-97
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 5.1e-23
Family B3 DNA binding domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Phvulv091022740m|PACid:23558532
Sequence length 435
Sequence
MARPCFHKLVLSTTIQSRQLRIPDTFLRKYGTQLSTIATLTVPDGSIWRIGLKKADNKIW
FVDGWQDFVQRYSVGVGYFLVFMYEGNSSFIVHIFNLSTAELNYQSAIRNHIEGPCYANY
NHIFEEMEDVDSIDLSDLSPAYLASGAMQNKGFAGSGDQLTPGKSHTPALQNLFNGGSKL
NRVNWGDGGSAYSSKAANSQGTQSTRDIGVQFNAVEFKRSTEELKLRYSNEESVNKTAKK
KRKSESQGEEPSGENEEEAEMRYRFYESASARKRTVTAEERERAINASKAFEPTNPFCRV
VLRPSYLYRGCIMYLPSCFAEKNLNGVSGFIKLQLSNGRQWSVRCLYRGGRAKLSQGWFE
FTVENNLGEGDVCVFELLRTKEVELQVTVFRVTEDAGLLHTPLAVQQQSQNMSHTKLLNP
HLQHRVSSTVKLIRN
Download sequence
Identical sequences V7C4R2
XP_007153153.1.22112 Phvulv091022740m|PACid:23558532

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]