SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Phvulv091022741m|PACid:23558533 from Phaseolus vulgaris v186

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Phvulv091022741m|PACid:23558533
Domain Number 1 Region: 209-310
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.12e-24
Family B3 DNA binding domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Phvulv091022741m|PACid:23558533
Sequence length 353
Sequence
MYEGNSSFIVHIFNLSTAELNYQSAIRNHIEGPCYANYNHIFEEMEDVDSIDLSDLSPAY
LASGAMQNKGFAGSGDQLTPGKSHTPALQNLFNGGSKLNRVNWGDGGSAYSSKAANSQGT
QSTRDIGVQFNAVEFKRSTEELKLRYSNEESVNKTAKKKRKSESQGEEPSGENEEEAEMR
YRFYESASARKRTVTAEERERAINASKAFEPTNPFCRVVLRPSYLYRGCIMYLPSCFAEK
NLNGVSGFIKLQLSNGRQWSVRCLYRGGRAKLSQGWFEFTVENNLGEGDVCVFELLRTKE
VELQVTVFRVTEDAGLLHTPLAVQQQSQNMSHTKLLNPHLQHRVSSTVKLIRN
Download sequence
Identical sequences V7C727
Phvulv091022741m|PACid:23558533 XP_007153154.1.22112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]