SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Phvulv091022755m|PACid:23558540 from Phaseolus vulgaris v186

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Phvulv091022755m|PACid:23558540
Domain Number 1 Region: 5-102
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 8.04e-19
Family B3 DNA binding domain 0.0036
Further Details:      
 
Domain Number 2 Region: 192-291
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 5.89e-16
Family B3 DNA binding domain 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Phvulv091022755m|PACid:23558540
Sequence length 293
Sequence
MSSQCQGVQFLKVIVESILQSGTMKVPTSFVSRHWQGMPNPVILSLPNGSKSKVFWLNQD
GGVWFCYGWKEFAKYSKLDVSHSIVFRYEGNSCFNVIIFGESGLEIEYPLSRDATNEEVG
EIDEASYFCANLSEERSKRPREEAQEEEEEKSNRQKTCSDYSKHKNSGTSSNGQEDFRTK
LRMLREKVEEMFNYNPNHFTCVIKEKHTERDLLVMPAEFAKPYLHKEGTATLFVEHGRTW
KVETEANSHKQLEVVFGWREFLLDNKLKLGDICAFEVLDRELLLFKVTICRLE
Download sequence
Identical sequences V7C6V6
Phvulv091022754m|PACid:23558541 Phvulv091022755m|PACid:23558540 XP_007153109.1.22112 XP_007153110.1.22112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]