SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Phvulv091022759m|PACid:23558515 from Phaseolus vulgaris v186

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Phvulv091022759m|PACid:23558515
Domain Number 1 Region: 5-102
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 8.63e-21
Family B3 DNA binding domain 0.0046
Further Details:      
 
Domain Number 2 Region: 198-296
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 6.87e-20
Family B3 DNA binding domain 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Phvulv091022759m|PACid:23558515
Sequence length 314
Sequence
MSSQYHGVHFFKVIVESTLQRGIMKIPTSFVRRHWEGMSNPVILSLPNGSKSKVFWQNKD
GGVWFCNGWKEFAKYSKLDVSHFIVFRYEGNSCFNVIIFGKSALEIEYPLSRDATNEEVE
EIDEGSDFSLKFSEERSKRPREEAQEEEEESPNKHKKRACSDYSKHKNTAGSSRASEHCK
GDFKKKLRMFHKKVKEMFKSNHKHFTCIIRKTYTERDLLIMPAEFAKPYLHKEGTATLFV
EHGRTWKVQTKVNSHEQFVFSSGWRKFLLDNKLKLGDVCAFEMLVSEPFLFKVTIYPLED
NSNTPLFKGIHYYY
Download sequence
Identical sequences Phvulv091022759m|PACid:23558515

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]