SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Phvulv091022760m|PACid:23558568 from Phaseolus vulgaris v186

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Phvulv091022760m|PACid:23558568
Domain Number 1 Region: 151-251
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.55e-19
Family B3 DNA binding domain 0.0052
Further Details:      
 
Domain Number 2 Region: 7-100
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000000471
Family B3 DNA binding domain 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Phvulv091022760m|PACid:23558568
Sequence length 284
Sequence
MSSQCHGVHFLKVFAEHNLQRGIMKVPTSFVSRHWEGMSNPVILSLPNGSKNKVFWVNKD
GDVWFCNGWKEFAKYSKLDVSHLLVFEGNSCFNVIIFGKSDLEIEYPLSRDATDEKVEEI
DEGTDSKPSENCKGDFKKKLIMFHEKVKETFKSNHEHFTCIIRKTYIERDLLIMPEEFGI
LYRHKEGNAATLFVEHGRTWEVQTKVNSYGQFVFSSGWRKFLWDNKLKLGDVCAFHEMLD
SEPFLFKVTIYPLEDNSSTSLFKGIHYHYYPNIYCDISRKLVNL
Download sequence
Identical sequences Phvulv091022760m|PACid:23558568

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]