SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Phvulv091022867m|PACid:23558543 from Phaseolus vulgaris v186

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Phvulv091022867m|PACid:23558543
Domain Number 1 Region: 202-307
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 5.89e-30
Family B3 DNA binding domain 0.00000586
Further Details:      
 
Domain Number 2 Region: 72-128
Classification Level Classification E-value
Superfamily DNA-binding domain 3.33e-17
Family GCC-box binding domain 0.00095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Phvulv091022867m|PACid:23558543
Sequence length 387
Sequence
MDCMDESTTTESLSISLSPTISSEDKLVPPSKNLSPPPPSNTLCRVGSGASAIVDPDGAG
NTEAESRKLPSSKYKGVVPQPNGRWGAQIYEKHQRVWLGTFNEEDEAARAYDIAAQRFRG
KDAVTNFKPVSGGDGDDDDGEAEFLNSHSKSEIVDMLRKHTYNDELEQSKRSRGVVRRRG
GAAGAGTGNSISGACFVKAREQLFEKAVTPSDVGKLNRLVIPKQHAEKHFPLQSVNGVSA
TAAKGVLLNFEDVGGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKNLKAGDTVCFHRSTGP
DKQLYIDWKARNNSVNEVGLFGPVGPVVEPIQMVRLFGVNILKLPGSEANNNNNASATIP
GFCNGKRREMELFSLECSKKPKIIGAL
Download sequence
Identical sequences V7CAG4
Phvulv091022867m|PACid:23558543 XP_007154354.1.22112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]