SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Phvulv091023156m|PACid:23559025 from Phaseolus vulgaris v186

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Phvulv091023156m|PACid:23559025
Domain Number 1 Region: 243-353
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.88e-30
Family B3 DNA binding domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Phvulv091023156m|PACid:23559025
Sequence length 741
Sequence
MYFQHPTPSHSHSSFFFSSLLFFHITYSLSTFSSSTNHQHVHFSLYLQQSSSSSSIINRH
NLTTFSSLYLTDHTTYFKQPFSPLCISVLCPLFPYLHLLLFFSATKKTLISFKPFLWVAF
SREKQGYLIFCIEMFKVMENMERSSERCLDSQLWHACAGAMVQMPPLNTKVFYFPQGHAE
HAHGKVDFGQTRVPPLVPCRLSGMKYMADPDTDEVYVKMRLIPLREHELDLEDDCFLGNT
GVEGQEKPPTSFAKTLTQSDANNGGGFSVPRYCAETIFPRLDYSAEPPVQTIIAKDMHGQ
CWKFRHIYRGTPRRHLLTTGWSNFVNQKRLVAGDSIVFLRAENGDLCVGIRRAKKGIGGG
SEFSSGWNPLFGGGSGFLCGSESSLVGGAKGGGDEMVGRVAAESVVEAISCAVNGSPFEV
VYYPRASSPEFCVKASVVKAAMQIQWCSGMRFKMPFETEDSSRISWFMGTISSVQVADPI
RWPDSPWRLLQVVWDEPDLLHNVKCVNPWLVELVSNMPTFNLSAYSPPRKKQRFVHDPYF
QVINQLPMPSFSSNLLNYTNSLCNIENSSSAGIQGARHAQFGLSPSDFPFNKLPAEMLLG
GFSRLDHATKPIRPPCGTYKNNTSNTTTKTNVDISCLLTVGNPNQNFKESNATKAPHILL
FGKLIHTEQKSSNTSSASTTGNSVSEGNSLKTSNASDGLGSALHQNSPIETNNSDGGSPW
YKEQHMADLGTDNVNTLCIAL
Download sequence
Identical sequences Phvulv091023156m|PACid:23559025

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]