SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Phvulv091024271m|PACid:23535279 from Phaseolus vulgaris v186

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Phvulv091024271m|PACid:23535279
Domain Number 1 Region: 107-213
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.88e-29
Family B3 DNA binding domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Phvulv091024271m|PACid:23535279
Sequence length 698
Sequence
MKETEKSLDPQLWHACAGGMVQMPPVNSKVFYFPQGHAEHAQSNLDFGASRIPIPPLVLC
RVAAVKFLADPETDEVFARLRLVPLRNTELDHEDGDNVDGNGAEGSEKPASFAKTLTQSD
ANNGGGFSVPRYCAETIFPRLDYSAEPPVQTVIAKDVHGEVWKFRHIYRGTPRRHLLTTG
WSSFVNQKKLVAGDSIVFLRAENGDLCVGIRRAKRGGVGGPEAPCGWSSGGGGGGGLGIG
PYGAFSAFLREESKVVRNGCGRPKVSGESVREAIALAANNQPFEIVYYPRANTPEFCIRT
SAVRGAMRIQWCSGMRFKMPFETEDSSRISWFMGTIASVQVLDPIRWPNSPWRLLQVTWD
EPDLLHNVKRVSPWLVELVSNVPVIHLAPFSPPRKKLRFPQHPEFPLDVQFPIPTFSGNP
FGSSTSSPLCCLSDNAPAGIQGARHAQIGITLSDLHLNNNKLQLGLLPTNVRQLDLHTGI
SNVNITNHGKSKESLSCLLTMGSSRKSLEKSDRVKRHQFLLFGQPILTEQQISRSSGDVF
SQNCTATDDENKEKKEKGFSDSQSSVSPGKSSSTTEFSWQLGSDTSHCKVFMESEDVGRT
LDLSCLGSYDELYMRLASMFGIERSEMLSHVLYRDATGALKQTGEEPFSEFMKTAKRLTI
LSDSSSKDSRRIWMTGTRNAEHGLDATSNKTGPMSIFA
Download sequence
Identical sequences V7BYQ5
XP_007150194.1.22112 Phvulv091024271m|PACid:23535279

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]