SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Phvulv091024272m|PACid:23535280 from Phaseolus vulgaris v186

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Phvulv091024272m|PACid:23535280
Domain Number 1 Region: 107-213
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.75e-29
Family B3 DNA binding domain 0.0014
Further Details:      
 
Weak hits

Sequence:  Phvulv091024272m|PACid:23535280
Domain Number - Region: 583-636
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0706
Family PB1 domain 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Phvulv091024272m|PACid:23535280
Sequence length 667
Sequence
MKETEKSLDPQLWHACAGGMVQMPPVNSKVFYFPQGHAEHAQSNLDFGASRIPIPPLVLC
RVAAVKFLADPETDEVFARLRLVPLRNTELDHEDGDNVDGNGAEGSEKPASFAKTLTQSD
ANNGGGFSVPRYCAETIFPRLDYSAEPPVQTVIAKDVHGEVWKFRHIYRGTPRRHLLTTG
WSSFVNQKKLVAGDSIVFLRAENGDLCVGIRRAKRGGVGGPEAPCGWSSGGGGGGGLGIG
PYGAFSAFLREESKVVRNGCGRPKVSGESVREAIALAANNQPFEIVYYPRANTPEFCIRT
SAVRGAMRIQWCSGMRFKMPFETEDSSRISWFMGTIASVQVLDPIRWPNSPWRLLQVTWD
EPDLLHNVKRVSPWLVELVSNVPVIHLAPFSPPRKKLRFPQHPEFPLDVQFPIPTFSGNP
FGSSTSSPLCCLSDNAPAGIQGARHAQIGITLSDLHLNNNKLQLGLLPTNVRQLDLHTGI
SNVNITNHGKSKESLSCLLTMGSSRKSLEKSDRVKRHQFLLFGQPILTEQQISRSSGDVF
SQNCTATDDENKEKKEKGFSDSQSSVSPGKSSSTTEFSWQLGSDTSHCKVFMESEDVGRT
LDLSCLGSYDELYMRLASMFGIERSEMLSHVLYRDATGALKQTGEEPFRYQSISCSSVIS
YSLFVFY
Download sequence
Identical sequences V7BW76
Phvulv091024272m|PACid:23535280 XP_007150195.1.22112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]