SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Phvulv091025614m|PACid:23533527 from Phaseolus vulgaris v186

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Phvulv091025614m|PACid:23533527
Domain Number 1 Region: 54-167
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000000334
Family B3 DNA binding domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Phvulv091025614m|PACid:23533527
Sequence length 173
Sequence
MSNPGDEKELCQKKRKSTICEASNFRTSRRRFCSNQSEEEMNKGVSTTLKLYDDPWKIKK
TLTDSDLGILSRLLLAADLVKKQILPMLGADHARAAETEEGTPVRVWDIDTKSMHQLVLK
RWSSSKSYVLIGKWNQDFVRRRDLKKGDEIGFHWDPYNCIFNFCVLKRAMPEN
Download sequence
Identical sequences V7AXT4
Phvulv091025614m|PACid:23533527 XP_007138390.1.22112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]