SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Phvulv091025990m|PACid:23544927 from Phaseolus vulgaris v186

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Phvulv091025990m|PACid:23544927
Domain Number 1 Region: 61-133
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000143
Family B3 DNA binding domain 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Phvulv091025990m|PACid:23544927
Sequence length 139
Sequence
MGGKDLELNDELQVEFIVDAGIVKDCELSLPYGVQLSNDKWNLFLPWLGFEETLIGFLKE
GEDVSEGIEVKVYDKGGHEFQMMLKKWVKDSNQFYVLNRGWFSFCNQHCLEQDDLIALRV
FRHAITDILSFVVTFRRMR
Download sequence
Identical sequences Phvulv091025990m|PACid:23544927

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]