SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Phvulv091026269m|PACid:23540014 from Phaseolus vulgaris v186

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Phvulv091026269m|PACid:23540014
Domain Number 1 Region: 118-256
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.05e-43
Family B3 DNA binding domain 0.0036
Further Details:      
 
Domain Number 2 Region: 541-615
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.000000000181
Family PB1 domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Phvulv091026269m|PACid:23540014
Sequence length 653
Sequence
MAFSASTHKSAGLLPGAINDDLYKELWHACAGPLVTLPREGERVYYFPQGHMEQLEASMY
EGLEQQMPSFNLPSKILCKVVNVHLRAESETDEVYAQITLLPELDQSEVTSPDDPLTESP
RVKIHSFCKTLTASDTSTHGGFSVLRRHADDCLPPLDMSQQPPWQELVATDLHGNEWHFR
HIFRGQPKRHLLTTGWSVFVSSKKLVAGDAFIFLRDENGELRVGVRRVMRQQSNVPSSVI
SSHSMHLGVLATASHAIATGTLFSVFYKPRTSRSEFIVSVNKYLEAKSHKLSVGMRFKMR
FEGDEIPERRFSGTIVGVGDNKSLVWPDSEWRSLKVQWDEPLSILRPDRVSSWELEPHVS
TTPANPQPTQRNKRARPLILTSTMPDSSLQGMWKSPVESTSFSYCDPQHGRGLYPSPKFN
PSATILGFSGNGFVGPPSNKSIYWSNRVQNFLESMSDTVPKEAGEKRQDTGNGCRLFGIQ
LLENSNAEECLQTVTLSGRLGDDRFVPSLDAESDQPSVSCDAEKSCLSPQELQSRQIRSC
TKVHMQGMAVGRAVDLTRFHGYQDLLKKLEEMFDIKTELCGSIKKWQVVYTDNEDDTMMV
GDDPWDEFCSVVRKIFIYTAEEVKKLSPKIGLSMNENRTSNPEEQSSNMGPSC
Download sequence
Identical sequences V7C6Z5
Phvulv091026269m|PACid:23540014 XP_007153915.1.22112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]