SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Phvulv091026576m|PACid:23546826 from Phaseolus vulgaris v186

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Phvulv091026576m|PACid:23546826
Domain Number 1 Region: 113-235
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.01e-29
Family B3 DNA binding domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Phvulv091026576m|PACid:23546826
Sequence length 551
Sequence
MPRQPPPPPPQQPGALEAAVWQACAGPSVEIPKPNSMVYYFAQGHFDQASSPPRNVSSAV
LARPFVTCNVVAVRFLADPLTDEVFAKMVLQPVANVFAAAAAPLHNHAAAPPQKDDKEVV
SFAKILTPSDANNGGGFSVPRFCADSIFPPLDYDEDPPVQNLSVTDVHGFTWEFRHIFRG
TPRRHLLTTGWSTFVNNKKLVAGDSVLFMKNADKRLLVGIRRATRFAPGRGSCVKLRLID
EEEEEEEEKEEVRGVFSRDGKGKLSAKEVVEAAELAVRNMQFEVVYYPKAGWSEFVVKTE
VVDAAMRIAWRDGMRVKMSVETDDSSRTTWFQGTVSAVSYQENGQWCSSPWRMLQVTWDE
PEGLQNAKWVSPWQVELVSTTPALHSAFPSPKRLRTANGSWVYANGEGDLFSMTGFTNPA
MGHLNQALWSYSTFPAGMQGARHDVFSASSFSSYPRDMSHLGMCNSFGNSTFSRLNNLSI
DPSPDSRSSLHSCVIDTVGNHKSNSTKPVSDSFQLFGAVIRKEQPVQSSLTGTGCASTGD
KKALEYKGSYL
Download sequence
Identical sequences V7ARK7
Phvulv091026576m|PACid:23546826 XP_007136195.1.22112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]