SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Phvulv091028231m|PACid:23544769 from Phaseolus vulgaris v186

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Phvulv091028231m|PACid:23544769
Domain Number 1 Region: 110-218
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 6.28e-29
Family B3 DNA binding domain 0.0017
Further Details:      
 
Weak hits

Sequence:  Phvulv091028231m|PACid:23544769
Domain Number - Region: 625-696
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0018
Family PB1 domain 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Phvulv091028231m|PACid:23544769
Sequence length 708
Sequence
MITFMDSKEKSKEAEKCLDPQLWHACAGGMVQMPAVNTKVYYFPQGHAEHACGAVNFRTC
PKVSPLVPCRVASIKYMADPETDEVYAKLRLAPMSVNDADYDRDVVGPETQDKPASFAKT
LTQSDANNGGGFSVPRYCAETIFPRLDYSADPPVQNILAKDVHGETWKFRHIYRGTPRRH
LLTTGWSTFVNHKKLVAGDSIVFLRAENGDLCVGIRRAKKGIGGGPEGSSGWNPAGGSCP
MAYGGFSPFLREEDNRILRNGNINGLNPSVTMTGRGKVRPEAVVEAANLAANKQPFEVVY
YPRASTPEFCVKAPLVEAALQIRWCSGIRFKMAFETEDSSRISWFMGTISSVQVADPLNW
PNSPWRLLQVTWDEPDLLQNVRRVSPWLVELVSNMPAIHLSPFSPPRKKLRLHQHPDFPL
DGQIHLPTFSGNLLGPSNTNQFGCLPESTPAGMQGARHAHYGLSISDLHFSKLHSGLFPA
GFPPLDHAATPMRISNNLTLQKPTISENVSCLLSMANSTQSSKKMDEGKKTPQLVLFGQK
ILTEQQISLSSSVDTFSPVLNRNCSSDGHADKVANFSDGSGSALHQHQQQHGQHQHQHER
SSCERFQWYRDNPQETEAGLETGHCKVFMESEDVGRTMDLSLLRSYDELYRRLTDMFGIE
KSEMLSQVLYRDSNGAVKHIGDEPFSDFIKSARRLTILMDSGSNNVGV
Download sequence
Identical sequences V7BEU5
Phvulv091028231m|PACid:23544769 XP_007144353.1.22112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]