SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Phvulv091028252m|PACid:23538361 from Phaseolus vulgaris v186

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Phvulv091028252m|PACid:23538361
Domain Number 1 Region: 17-114
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 5.89e-25
Family B3 DNA binding domain 0.0025
Further Details:      
 
Domain Number 2 Region: 177-266
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 7.65e-16
Family B3 DNA binding domain 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Phvulv091028252m|PACid:23538361
Sequence length 285
Sequence
MTSKLNQRDDSHGGSASKPIHFFRIMLSHNLLHGKLRLPSKFVSKYGNHLPNTIFLKLPN
DAEWEVKLEKSDGSVWFQQGWKEFVEYHCLAHGHLLVFRYNGTSHFHVLICDMSCMEIDY
PVNKANQKRVRINSEDIQPAKTQKPTQNEKRSDEDVRDHKGILKNLNEGKKKMEAVGNTS
FMVILKPSNLITGYMYLPKVPVRSYIKRREQYITLLVGDRSWRVKLIHYRNNTAYFTNFL
DFARENDLKEGDACFFQLINMGDDMVFRATFCKQTLLSSRVLKGQ
Download sequence
Identical sequences Phvulv091028252m|PACid:23538361

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]