SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Phvulv091029716m|PACid:23556089 from Phaseolus vulgaris v186

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Phvulv091029716m|PACid:23556089
Domain Number 1 Region: 111-256
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.14e-49
Family B3 DNA binding domain 0.0065
Further Details:      
 
Domain Number 2 Region: 709-788
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.000000314
Family PB1 domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Phvulv091029716m|PACid:23556089
Sequence length 840
Sequence
MKLSTSGLGQQGLEGEKKCLNSELWHACAGPLVSLPTAGTRVVYFPQGHSEQVAATTNRE
IDGHIPNYPSLPPQLICQLHNVTMHADVETDEVYAQMTLQPLTPQEQKDTFLPMELGIPS
KQPSNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFSQQPPAQELIARDLHDVEWKFR
HIFRGQPKRHLLTTGWSIFVSAKRLVAGDSVLFIWNEKNQLLLGIRRANRPQTVMPSSVL
SSDSMHIGLLAAAAHAAATNSCFTVFYNPRASPSEFVIPLSKYIKAVYHTRISVGMRFRM
LFETEESGVRRYMGTITGISDLDSVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIEPLT
TFPMYPSLFPLRLKRPWHPGSSSLHDGSRDEASNGLMWLRGGPGDQGLNSLNFQGGGMLP
WMQQRMDPTLLGSDQNQQYQAMLAAGLQNLGSGYLMKQQMMNFQQPFHYLQQSGNSSSPL
QLQPQQSIQQSVSSNMLQPQAHVLTENLSQHLLQKPHNNQEVQAQQQQHSFQDPLLIPSD
QLPQRQHSGVPSPSYSKPDFLDSSMKFPASVSPGQNMLSSLCPEGSANLLNLSRSGPSLL
SEQLPQQQWTQKYAPMQVNAYGSTVQYSGKDSAMVLPHLNSDTQNSTLFGVNIDSSGLLL
PTTVPGYSTSSADTNSSTMPLGESGFQGSLFGCMQDSSELLQSAGHVDPQNQTQTFVKVY
KSGSVGRSLDISRFSSYHELREELAQMFGIEGKLEDPPRSGWQLVFVDRENDVLLLGDDP
WESFVNNVWYIKILSPEDIQKMGEQAVESLALGSGQRLNGTGAESQDIVSGPPSIGSLDY
Download sequence
Identical sequences V7BPI4
Phvulv091029716m|PACid:23556089 XP_007146949.1.22112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]