SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Phvulv091003593m|PACid:23552026 from Phaseolus vulgaris v186

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Phvulv091003593m|PACid:23552026
Domain Number 1 Region: 172-284
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.27e-29
Family B3 DNA binding domain 0.0000083
Further Details:      
 
Domain Number 2 Region: 53-109
Classification Level Classification E-value
Superfamily DNA-binding domain 2.42e-17
Family GCC-box binding domain 0.00097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Phvulv091003593m|PACid:23552026
Sequence length 361
Sequence
MDAGSSTDETTTTSDSLSLPPNQSPPPLIRVGSGGVDPDAVSGEAESRKLPSSKYKGVVP
QPNGRWGAQIYEKHQRVWLGTFNEEDEAARAYDIAAQRFRGRDAVTNFKPLAGAGDDAES
EFLNSHSKSEIVDMLRKHTYDDELQQSTRCGRRRRAAEAASSGAFDPQAREQLFEKTVTP
SDVGKLNRLVIPKQHAEKHFPLSTGSGSGVSLCTAAAAAKGVLLNFEDVGGKVWRFRYSY
WNSSQSYVLTKGWSRFVKENNLRAGDAVRFFKSTGPDRQLYIDCKARSSGGICELNNNNA
GGLFVPVGPVVEQVQMVRLFGVNLLKLPGSDGVRVGYEGKRKEMELFAFECSKKLKVIGA
L
Download sequence
Identical sequences V7BDZ9
XP_007143801.1.22112 Phvulv091003593m|PACid:23552026

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]