SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Phvulv091009029m|PACid:23541023 from Phaseolus vulgaris v186

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Phvulv091009029m|PACid:23541023
Domain Number 1 Region: 162-242
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000994
Family Eukaryotic type KH-domain (KH-domain type I) 0.0025
Further Details:      
 
Domain Number 2 Region: 263-294
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000000157
Family CCCH zinc finger 0.0016
Further Details:      
 
Domain Number 3 Region: 98-131
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000000209
Family CCCH zinc finger 0.002
Further Details:      
 
Domain Number 4 Region: 35-60
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000772
Family CCCH zinc finger 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Phvulv091009029m|PACid:23541023
Sequence length 298
Sequence
MDHRKRGRSEATFNVNGGAKKFRPETDSFPTGLGSKSKPCTKFFSTSGCPFGEGCHFLHY
VPGGFKAVSQLINVGSDPAIPHAGRNPILPSFPDGSSPPVVKTRLCNKFNTAEGCKFGDK
CHFAHGEWELGRPTAPSYEDPRVMGQMPNSRIGGRGEPPFPGHGAAASFGASATAKISIN
ASLAGAVIGKSGVNSKQICRVTGAKLAVRDHDTDSNLRNIELEGSLDQIKQASAMVHELI
LNISAASGPPIKSFSTQNSAPTSNFKTKLCGNFTKGSCTFGERCHFAHGTDDLRKTGM
Download sequence
Identical sequences V7BAK0
Phvulv091009029m|PACid:23541023 XP_007142616.1.22112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]