SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Phvulv091010813m|PACid:23549045 from Phaseolus vulgaris v186

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Phvulv091010813m|PACid:23549045
Domain Number 1 Region: 834-1172,1275-1318
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.38e-70
Family FAD-linked reductases, N-terminal domain 0.0000457
Further Details:      
 
Domain Number 2 Region: 1154-1265
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 9.81e-29
Family L-aminoacid/polyamine oxidase 0.00046
Further Details:      
 
Domain Number 3 Region: 583-681
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000143
Family SWIRM domain 0.036
Further Details:      
 
Domain Number 4 Region: 1414-1498
Classification Level Classification E-value
Superfamily Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.0000204
Family Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Phvulv091010813m|PACid:23549045
Sequence length 1908
Sequence
MEGEDVRSGTRKKRSKKEIGFDSDDDEPIGSIFKLKRAKRKGSGSGEAVREKEDLGGMDD
NDTLASFRKRLKGPKRDQGSGVARGPSSALHVSDEDLVGLGAKGKDEKGVALVPGGVDMQ
MQMQDSSDQHMEDSLSAIFHKAQSSSARKSRVGSRQKRGIQKVDGGLSPGGFVEAVDSVV
ESRSGSASGSKLVGGNAMSDDALPQASEPVVTSVVEDQKCVNDCFQEEIAKGECDLDIPD
GLNQPKDVYHDDGKQFSCALKAEDISCDSDQKVALQESVVISGGLHKLSSMLLDEIVDTA
YLSKVGEGESQLTEVGEPENRLTDELVQACNSASEHDVSTSAGKGNVLTSWHTEPLIKST
ENVLKENDDMVSGKGFQESSRNGALKLSGCHLEVDGGGKSETEFVSDGNLCDYSNLDTKA
EVQDFVLGFSPKRNDVTVSGSSMVSNEAELDARSNHPEKPIEACNIPKGPTVSILKCSSV
LDPVHSDGSSLQSSIPDENGNSAEYHTSVSDFVDNDGKISGITRVVRKTKMRKHGDMTYE
GDADWEVLINDQTLNESQVMTDVDRTLRTRMKHDTSLNTGEESENVAVVAVSAGLKARKA
GPIEKIKFKEILKRKGGLKEYLDCRNQILSLWSRDVTRILPLAECGVSDTDYEDGSPRSS
LIREVYAFLDQYGYINVGIASQKENVGSSARHCYKLVKEKGFEESLAASMADSEDGVSFL
VGQTKMSDTFNEINNGLPKDCNDLTTEATEGMGHSNEVKLDLPNISQQAEGKKIDYQEND
GFQDGTIDSSVPSSNFADCRLTSLVAKEKSNDSTCIKSVWGGQVGDNLQSDLDPRKRVIV
IGAGPAGLTAARHLQRQGFPVTVLEARGRIGGRVFTDHSSLSVPVDLGASIITGVEADVA
TERRPDPSSLICAQLGLELTVLNSDCPLYDIVTEQKVPADMDEALEAEYNTLIDDMVLVV
AQKGEQAMRMSLEDGLEYALKIRRMARSESSEETEQNNSADRPFDSKRDSSVEKKLDEEI
LSPQERRVMDWHFAHLEYGCAASLNDVSLPYWNQDDVYGGFGGAHCMIKGGYSSVVESLG
EGNTIHLNHVVTNVSYGIREPGQSYKVKVSTSNGNEFFGDAVLVTVPLGCLKAETIQFSP
PLPQWKCSSVQRLGYGVLNKVALEFPSVFWDDAVDYFGATAEERNSRGHCFMFWNVRKTV
GAPVLIALVVGKAAIDGQSLSSSDHVKHALKVLRKLFGQDSVPDPVAYVVTDWGRDPFSY
GAYSYVKVGASGEDYDILGRPVDNCLFFAGEATCKEHPDTVGGAMMSGLRESVRIIDILS
TGNDYIAEVEALEAARGQLDPERDEVRDIIKRLDAVELSNIMYKNSLDGAQILTREALLR
EMFFNTKTTGGRLHVAKQLLTLSVGNLKSFAGSKEGLAILNSWILDSMGKDGTQLLRHCL
RLLVRVSTDLLAVRLSGMGKTVKEKVCVHTSRDIRAIASQLVNVWLEVFRKEKASNGGLK
LPKQTTVLDLSKRKSAKDSALGKPPLGTYHGTIENKGGLLNPTSAGSNSPSHAHMKKLQS
KQGRQPAAYDSRHEVSSSKSKGSIDRVATEKEDSHCAISEEEQAAIAAAEAARAKALAAA
EAYASAEARCNSLLQLPKIPSFHKFARREQSSQNDECDSKKRWSGGVFGRQDCISEIDSR
NCRVRDWSVDFSAACVNLDNSRMPVDNLSQRSHSNEIASHLNFREHSGESVAGDSSIYTK
AWIDTAGGVAIKDHHAIERWQSQAAAADSYFSNPTIHLKDEEDSNACSKLPSWKRDGVAN
ESSISQVTVNKDALKSHSRAADHIKQAVVDYVASLLMPLYKARKLDKDGYKAIMKKSATK
FQVMEQATDAEKAMTVREFLDFKRKNKIRSFVDILIERHMTMKSDMKS
Download sequence
Identical sequences Phvulv091010813m|PACid:23549045

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]